I'm Awake, Please Respect My Privacy Sticker

I'm Awake, Please Respect My Privacy Sticker

UGS: IMAWAKEPLSERESPCTMYPRIVSTICKER021526

Prix régulier $3.99 Solde


détails du produit

I'm Awake, Please Respect My Privacy Sticker: Funny Introvert Vinyl Decal

The I'm Awake, Please Respect My Privacy Sticker is a 3" x 3" printed vinyl decal designed for personalizing water bottles, laptops, and everyday gear. Featuring clean typography and deadpan comedic styling, this novelty sticker gives fair warning to coworkers, roommates, and family before unwanted morning conversation begins. It serves as an essential badge for introverts, night owls, and anyone who requires complete silence and a full cup of caffeine before engaging with the outside world.

Manufactured from heavy-duty outdoor-grade vinyl, this durable decal is shielded with a scratch-resistant, weatherproof UV laminate that protects against sun fading, rain, and daily wear. The surface-safe adhesive provides a firm bond across smooth surfaces like tumblers, phone cases, vehicle windows, and notebooks, yet peels away cleanly without leaving gummy residue behind. It delivers sharp sarcasm to your daily carry while holding up against heavy use.

I'm Awake, Please Respect My Privacy Sticker Specifications:

  • Dimensions: Approximately 3" x 3"
  • Product Type: Novelty vinyl decal
  • Material: Heavy-duty outdoor vinyl
  • Finish: Weatherproof and UV-resistant gloss laminate
  • Adhesive: Clean-removal adhesive (zero residue)
  • Application: Tumblers, laptops, skateboards, car windows, and notebooks
  • Theme: Introvert humor / sarcasm

Avis sur les produits

Produit récemment consulté

Loading...